B-type Natriuretic Peptide Human - 25mg

cytokine
cytokinecytokine
Catalog #: CYT-369Description:B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton.Synonyms:NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.Amino Acid Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH.Purity:Gr ...Read more
Catalog # CYT-369 $825.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: CYT-369

Description:
B-type Natriuretic Peptide Human is a polypeptide chain containing 32 amino acids and having a molecular mass of 3464 Dalton.

Synonyms:
NPPB, Natriuretic Peptide Precursor B, BNP, B-type Natriuretic Peptide.

Amino Acid Sequence:
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH-OH.

Purity:
Greater than 98.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility:
It is recommended to reconstitute the lyophilized B-type Natriuretic Peptide in sterile 18MΩ–cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Formulation:
The protein was lyophilized without additives.

Stability:
Lyophilized B-type Natriuretic Peptide although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution B-type Natriuretic Peptide should be stored at 4 °C between 2-7 days and for future use below -18 °C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.

Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

We have 639 researchers online

Your Purchases