Eotaxin-2 Human Recombinant (CCL24) - 20µg

chemokine
Catalog #: CHM-238Description:CCL24 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 8.8 kDa.The CCL24 is purified by proprietary chromatographic techniques.Synonyms:C-C motif chemokine 24, Small-inducible c ...Read more
Catalog # CHM-238 $225.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: CHM-238

Description:
CCL24 Human Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 78 amino acids and having a molecular mass of 8.8 kDa.
The CCL24 is purified by proprietary chromatographic techniques.

Synonyms:
C-C motif chemokine 24, Small-inducible cytokine A24, Myeloid progenitor inhibitory factor 2, CK-beta-6, Eosinophil chemotactic protein 2, Eotaxin-2, CCL24, Ckb-6, MPIF2, MPIF-2, SCYA24, Eotaxin2, CCL-24.

Source:
Escherichia Coli.

Amino Acid Sequence:
VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKGGVIFTTKKGQQFCG
DPKQEWV QRYMKNLDAKQKKASPRARAVA.

Purity:
Greater than 97.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility:
It is recommended to reconstitute the lyophilized CCL24 Human Recombinant in sterile 18MΩ–cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Formulation:
The CCL24 protein was lyophilized from a concentrated (1mg/ml) sterile solution containing 20mM PBS pH-7.4 and 0.15M sodium chloride.

Stability:
Lyophilized Eotaxin-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution CCL24 should be stored at 4 °C between 2-7 days and for future use below -18 °C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Activity:
The activity is determined by the chemoattract of human PBE (peripheral blood eosinophils) at a concentration between 50-100 ng/ml corresponding to a Specific Activity of 10,000-20,000IU/mg.

Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.

Usage:
Denovo Biotechnology products are furnished for LABORATORY RESEARCH USE ONLY. The products may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

We have 761 researchers online

Your Purchases