HCC-1 Human Recombinant (CCL14) - 10µg

chemokine
Catalog #: CHM-311Description:HCC-1 Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 72 amino acids and having a molecular mass of 8411 Dalton.The HCC-1 is purified by proprietary chromatographic techniques.Synonyms:Small inducible cytokine A14, CCL14, ...Read more
Catalog # CHM-311 $225.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: CHM-311

Description:
HCC-1 Human Recombinant produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 72 amino acids and having a molecular mass of 8411 Dalton.
The HCC-1 is purified by proprietary chromatographic techniques.

Synonyms:
Small inducible cytokine A14, CCL14, Chemokine CC-1/CC-3, HCC-1/HCC-3, HCC-1(1-74), NCC-2, chemokine (C-C motif) ligand 14, CC-1, CC-3, CKb1, MCIF, SY14, HCC-1, HCC-3, SCYL2, SCYA14.

Source:
Escherichia Coli.

Amino Acid Sequence:
TESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHS
VCTNPSDKWVQDYIKDMKEN.

Purity:
Greater than 97.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility:
It is recommended to reconstitute the lyophilized HCC-1 in sterile 18MΩ–cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Formulation:
The CCL14 protein was lyophilized with 20mM PBS pH-7.4 and 150mM NaCl.

Stability:
Lyophilized HCC1 although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution CCL14 should be stored at 4 °C between 2-7 days and for future use below
-18 °C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Activity:
The Biological activity is calculated by its ability to chemoattract Human monocytes at 5-20ng/ml corresponding to a Specific Activity of 50,000-200,000IU/mg.

Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.

Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

We have 1067 researchers online

Your Purchases