Monocyte Chemotactic Protein-4 Human Recombinant (CCL13) - 10µg

chemokine
Catalog #: CHM-319Description:Monocyte Chemotactic Protein-4 Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 75 amino acids and having a molecular mass of 8.6 kDa. The MCP-4 is purified by proprietary chromatographic techniques.Synonyms:Small inducible cytoki ...Read more
Catalog # CHM-319 $225.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: CHM-319

Description:
Monocyte Chemotactic Protein-4 Human Recombinant produced in E.Coli is a non-glycosylated, Polypeptide chain containing 75 amino acids and having a molecular mass of 8.6 kDa. The MCP-4 is purified by proprietary chromatographic techniques.

Synonyms:
Small inducible cytokine A13, CCL13, Monocyte chemotactic protein 4, MCP-4, Monocyte chemoattractant protein 4, CK-beta-10, NCC-1, chemokine (C-C motif) ligand 13, NCC1, CKb10, SCYL1, SCYA13, MGC17134.

Source:
Escherichia Coli.

Amino Acid Sequence:
QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAV
IFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT.

Purity:
Greater than 96.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility:
It is recommended to reconstitute the lyophilized MCP-4 in sterile 18M-cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Formulation:
The protein was lyophilized from a concentrated (1mg/ml) sterile solution in 20mM PB, pH 7.4, 130mM NaCl.

Stability:
Lyophilized MCP-4 although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution MCP-4 should be stored at 4 °C between 2-7 days and for future use below -18 °C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.

Activity:
The specific activity as determined by the ability of MCP-4 to chemoattaract human monocytes at 10-100ng/ml, corresponding to a Specific Activity of 10,000-100,000 units/mg.

Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.

Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

We have 1062 researchers online

Your Purchases