Melanoma Inhibitory Activity Human Recombinant - 20µg

growth factor
growth factorgrowth factor
Catalog #: CYT-310Description:Melanoma Inhibitory Activity Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain consisting of 108 amino having a total molecular mass of 12237 Dalton.The MIA is purified by proprietary chromatographic techniques.Synonyms:Melanoma-deriv ...Read more
Catalog # CYT-310 $225.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: CYT-310

Description:
Melanoma Inhibitory Activity Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain consisting of 108 amino having a total molecular mass of 12237 Dalton.
The MIA is purified by proprietary chromatographic techniques.

Synonyms:
Melanoma-derived growth regulatory protein precursor, Cartilage-derived retinoic acid-sensitive protein, CD-RAP, MIA.

Source:
Escherichia Coli.

Amino Acid Sequence:
Agrees with the sequence of native MIA human with an addition N-terminal Methionine residue.
MGPMPKLADRKLCADQECSSHPISMAVALQDYMAPDCRFLTIHRGQVV
YVFSLKGRGRFLWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKVDVKT
DKWDFYCQ.

Purity:
Greater than 95.0% as determined by:
(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.

Solubility:
It is recommended to reconstitute the lyophilized Melanoma Inhibitory Activity in sterile 18MΩ–cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.

Formulation:
The protein was lyophilized from a concentrated (1mg/ml) solution containing 20mM Potassium-phosphate pH=7 and 150mM potassium chloride.

Stability:
Lyophilized MIA although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution MIA should be stored at 4 °C between 2-7 days and for future use below -18 °C.
Please prevent freeze-thaw cycles.

Activity:
The biological activity is calculated by the inhibiting effect on the invasion of Mel In Tumor cells and found active in Mel In assay.

Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.

Protein Content:
UV spectroscopy at 280 nm using the absorption coefficient of 19300 M-1cm-1.

Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.

We have 400 researchers online

Your Purchases