- Description
- Specifications
Catalog #: PRO-402
Description:
Recombinant streptococcal protein G lacking the albumin binding region thereby avoiding undesirable reactions with albumin, though the Fc binding domain is still present. The recombinant Protein G is produced in Escherichia coli using sequence from Streptococcus C1-C2-C3. The Protein G contains amino acids 190-384 having a molecular mass of 21.6 kDa. The Protein-G migrates on SDS-PAGE around 32 kDa.
Amino Acid Sequence:
MTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDAT KTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTEAVDAATAEKVFK QYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTL KGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTE.
Applications:
Protein G binds to the constant region of many species of immunoglobulin G. It can be used to detect, quantify and purify IgG antibodies and antibody/antigen complexes. Recombinant Protein G contains only IgG binding domains. The albumin-binding domain as well as cell wall and cell membrane binding domains have been removed to ensure the maximum specific IgG binding capacity.
Purity:
>95% as determined by SDS-PAGE and RP-HPLC.
Formulation:
Lyophilized white Powder containing no additives.
Specificity:
1. Binds with greater affinity to most mammalian immunoglobulins than Protein A, including human IgG3 and rat IgG2a.
2. Does not bind to human IgM, IgD and IgA.
Reconstitution:
Reconstitution with deionized water or PBS.
Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.
Storage:
Lyophilized Recombinant Protein G although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution Protein G should be stored at 4 °C between 2-7 days and for future use below -18 °C.
Please prevent freeze-thaw cycles.
Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
