- Description
- Specifications
Catalog #: CYT-429
Description:
B Lymphocyte Stimulator Receptor Human Recombinant extracellular produced in E.Coli is a single, non-glycosylated polypeptide chain containing 76 amino acids and having a molecular mass of 7.7 kDa.
The BAFF-R is purified by proprietary chromatographic techniques.
Synonyms:
TNFRSF13C, CD268, BAFF-R, MGC138235, B cell-activating factor receptor.
Source:
Escherichia Coli.
Amino Acid Sequence:
MRRGPRSLRGRDAPAPTPCVPAECFDLLVRHCVACGLLRTPRPKPAG
ASSPAPRTALQPQESVGAGAGEAALPLPG.
Purity:
Greater than 95.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Solubility:
It is recommended to reconstitute the lyophilized B Lymphocyte Stimulator Receptor Recombinant in sterile 18MΩ–cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Formulation:
Lyophilized from a 0.2µm filtered concentrated (1.0mg/ml) solution in 20mM PB, pH 8.0, 500mM NaCl.
Stability:
Lyophilized BAFF-R although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution B Lymphocyte Stimulator Receptor should be stored at 4 °C between 2-7 days and for future use below -18 °C.
Please prevent freeze-thaw cycles.
Activity:
Determined by its ability to block BAFF induced mouse splenocyte survival. The expected ED50 for this effect is 1000-5000ng/ml corresponding to a Specific Activity of 200-1000IU/mg in the presence of 1.0?g/ml of human soluble BAFF.
Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.
Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
