- Description
- Specifications
Catalog #: CHM-235
Description:
Fractalkine Human Recombinant- produced in E.Coli is a single,non-glycosylated, polypeptide chain containing 76 amino acids and having a molecular mass of 8638 Dalton.
The Fractalkine is purified by proprietary chromatographic techniques.
Synonyms:
Fractalkine, CX3CL1, Neurotactin, CX3C membrane-anchored chemokine, Small inducible cytokine D1, NTN, NTT, CXC3, CXC3C, SCYD1, ABCD-3, C3Xkine.
Source:
Escherichia Coli.
Amino Acid Sequence:
QHHGVTKCNITCSKMTSKIPVALLIHYQQNQASCGKRAIILETRQHRLFCADPKEQW VKDAMQHLDRQAAALTRNG.
Purity:
Greater than 97.0% as determined by(a) Analysis by RP-HPLC.
(b) Analysis by SDS-PAGE.
Solubility:
It is recommended to reconstitute the lyophilized CX3CL1 in sterile 18MΩ–cm H2O not less than 100 µg/ml, which can then be further diluted to other aqueous solutions.
Formulation:
The CX3CL1 was lyophilized from a 0.2µm filtered concentrated (1.0 mg/ml) solution in 20mM Phosphate buffer, pH 7.4, 50mM NaCl.
Stability:
Lyophilized CX3CL1 although stable at room temperature for 3 weeks, should be stored desiccated below -18 °C. Upon reconstitution CX3CL1 should be stored at 4 °C between 2-7 days and for future use below -18 °C.
For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA).
Please prevent freeze-thaw cycles.
Activity:
The Biological activity is calculated by its ability to chemoattract human T-Lymphocytes using a concentration range of 5.0-10.0 ng/ml corresponding to a Specific Activity of 100,000-200,000IU/mg.
Physical Appearance:
Sterile Filtered White lyophilized (freeze-dried) powder.
Usage:
Denovo Biotechnology's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
References:
Title: Glial Cell Line-Derived Neurotrophic Factor and Neurturin Inhibit Neurite Outgrowth and Activate RhoA through GFR?2b, an Alternatively Spliced Isoform of GFR?2.
Publication: The Journal of Neuroscience, 23 May 2007, 27(21): 5603-5614; doi: 10.1523/?JNEUROSCI.4552-06.2007.
Link: http://www.jneurosci.org/content/27/21/5603.full
Applications: GFR?2 when activated by NTN, it inhibits neurite outgrowth induced by GFR?1a, GFR?2a, and GFR?2c isoforms.
