Hepatitis B Surface Antigen, preS2 Recombinant - 50µg

inf dis
inf disinf dis
Catalog #: HBS-874Description:The E.coli derivedRecombinant Hepatitis B Surface Antigen preS2 is a single non-glycosylated polypeptide chain containing 55 amino acids & having a molecular weight of5.7 kDa.Amino Acid Sequence:MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN.Applications:1. ...Read more
Catalog # HBS-874 $225.00 each


100 items in stock
Add to cart
  • Description
  • Specifications

Catalog #: HBS-874

Description:
The E.coli derivedRecombinant Hepatitis B Surface Antigen preS2 is a single non-glycosylated polypeptide chain containing 55 amino acids & having a molecular weight of5.7 kDa.

Amino Acid Sequence:
MQWNSTTFHQALLDPKVRGLYFPAGGSSSGTVNPVPTTASP
ISSIFSRTGDPAPN.

Applications:
1. Immunochromatography (capture and conjugate).
2. Preparing monoclonal or polyclonal antibodies for HBsAg-preS2.
3. ELISA.

Purification Method:
HBsAg protein was purified by proprietary chromatographic technique.

Purity:
HBsAg protein is >95% pure as determined by 10% PAGE (coomassie staining).

Solubility:
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at

We have 205 researchers online

Your Purchases

The cart is empty